PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc04660.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 88aa    MW: 9839.47 Da    PI: 10.9165
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc04660.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF80.71e-253686151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krien+ nrqvtfskRr+g++KKA+ L +LCda++ vi+f +tg+ly++s+
  Zpz_sc04660.1.g00010.1.am.mk 36 KRIENEANRQVTFSKRRAGVFKKAKGLATLCDAQIGVIVFTNTGQLYDFSN 86
                                  79***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006626.4922888IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.66E-232887IPR002100Transcription factor, MADS-box
SMARTSM004326.2E-322887IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-243050IPR002100Transcription factor, MADS-box
PfamPF003192.9E-233784IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-245065IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-246586IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
LWVLSPPLSF LSPVRKPAGD QCPESRLMVR GKTVLKRIEN EANRQVTFSK RRAGVFKKAK  60
GLATLCDAQI GVIVFTNTGQ LYDFSNSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641670.13e-26PREDICTED: MADS-box transcription factor 23-like
RefseqXP_015641671.13e-26PREDICTED: MADS-box transcription factor 23-like
SwissprotA2RVQ51e-23AGL16_ARATH; Agamous-like MADS-box protein AGL16
TrEMBLI1Q2931e-27I1Q293_ORYGL; Uncharacterized protein
TrEMBLA0A0D3GGC51e-27A0A0D3GGC5_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0E1J21e-27A0A0E0E1J2_9ORYZ; Uncharacterized protein
TrEMBLA2YCP02e-27A2YCP0_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0A9B32e-27A0A0E0A9B3_9ORYZ; Uncharacterized protein
TrEMBLQ5Z5L92e-27Q5Z5L9_ORYSJ; MADS-box protein-like
TrEMBLA0A0P0WWA73e-27A0A0P0WWA7_ORYSJ; Os06g0347700 protein
STRINGBGIOSGA022872-PA5e-27(Oryza sativa Indica Group)
STRINGLOC_Os06g23950.15e-27(Oryza sativa Japonica Group)
STRINGORGLA06G0125600.13e-27(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3566134
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.25e-25AGAMOUS-like 16